SCOP 1.61: Domain d1bvnp1: 1bvn P:404-496

Lineage for d1bvnp1 (1bvn P:404-496)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)

4. Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family)

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (14 proteins)

6. Protein Animal alpha-amylase [51024] (3 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [51025] (11 PDB entries)

8. Domain d1bvnp1: 1bvn P:404-496 [27767]
   Other proteins in same PDB: d1bvnp2, d1bvnt_

Details for d1bvnp1

PDB Entry: 1bvn, 2.5 Å

PDB Description: pig pancreatic alpha-amylase in complex with the proteinaceous inhibitor tendamistat

SCOP Domain Sequences for d1bvnp1:

Sequence; same for both SEQRES and ATOM records:

>d1bvnp1 b.71.1.1 (P:404-496) Animal alpha-amylase {Pig (Sus scrofa)}
qpfanwwdngsnqvafgrgnrgfivfnnddwqlsstlqtglpggtycnvisgdkvgnsct
gikvyvssdgtaqfsisnsaqdpfiaihaeskl

Timeline for d1bvnp1:

• d1bvnp1 first appeared (with stable ids) in SCOP 1.55
  
• d1bvnp1 appears in SCOP 1.59
  
• d1bvnp1 appears in SCOP 1.63
  
• d1bvnp1 appears in the current release, SCOPe 2.08