Lineage for d1bvnp1 (1bvn P:404-496)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 114424Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 114425Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 114426Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (12 proteins)
  6. 114432Protein Animal alpha-amylase [51024] (3 species)
  7. 114447Species Pig (Sus scrofa) [TaxId:9823] [51025] (8 PDB entries)
  8. 114455Domain d1bvnp1: 1bvn P:404-496 [27767]
    Other proteins in same PDB: d1bvnp2, d1bvnt_

Details for d1bvnp1

PDB Entry: 1bvn (more details), 2.5 Å

PDB Description: pig pancreatic alpha-amylase in complex with the proteinaceous inhibitor tendamistat

SCOP Domain Sequences for d1bvnp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvnp1 b.71.1.1 (P:404-496) Animal alpha-amylase {Pig (Sus scrofa)}
qpfanwwdngsnqvafgrgnrgfivfnnddwqlsstlqtglpggtycnvisgdkvgnsct
gikvyvssdgtaqfsisnsaqdpfiaihaeskl

SCOP Domain Coordinates for d1bvnp1:

Click to download the PDB-style file with coordinates for d1bvnp1.
(The format of our PDB-style files is described here.)

Timeline for d1bvnp1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bvnp2
View in 3D
Domains from other chains:
(mouse over for more information)
d1bvnt_