Class b: All beta proteins [48724] (176 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (37 species) not a true protein |
Species Rotavirus a [TaxId:28875] [277665] (1 PDB entry) |
Domain d4yfwb_: 4yfw B: [277668] automated match to d3taya_ |
PDB Entry: 4yfw (more details), 1.66 Å
SCOPe Domain Sequences for d4yfwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yfwb_ b.29.1.0 (B:) automated matches {Rotavirus a [TaxId: 28875]} ldgpytpdssnlpsnywylinplndgvvfsvtnnstfwmftylilpntaqtnvtvnvmne tvnisidnsgstyrfvdyfktsstqsyrqrnylitehrlqayrrdesgnisnywgsstyg dlrvgtyfnpvlnavinlnadfyiipdsqqekcteyikggl
Timeline for d4yfwb_: