Lineage for d1pif_1 (1pif 404-496)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63005Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 63006Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 63007Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (11 proteins)
  6. 63008Protein Animal alpha-amylase [51024] (3 species)
  7. 63020Species Pig (Sus scrofa) [TaxId:9823] [51025] (8 PDB entries)
  8. 63026Domain d1pif_1: 1pif 404-496 [27765]
    Other proteins in same PDB: d1pif_2

Details for d1pif_1

PDB Entry: 1pif (more details), 2.3 Å

PDB Description: pig alpha-amylase

SCOP Domain Sequences for d1pif_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pif_1 b.71.1.1 (404-496) Animal alpha-amylase {Pig (Sus scrofa)}
qpfanwwdngsnqvafgrgnrgfivfnnddwqlsstlqtglpggtycnvisgdkvgnsct
gikvyvssdgtaqfsisnsaqdpfiaihaeskl

SCOP Domain Coordinates for d1pif_1:

Click to download the PDB-style file with coordinates for d1pif_1.
(The format of our PDB-style files is described here.)

Timeline for d1pif_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pif_2