Lineage for d1pif_1 (1pif 404-496)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily) Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) 
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (11 proteins) Protein Animal alpha-amylase [51024] (3 species) Species Pig (Sus scrofa) [TaxId:9823] [51025] (8 PDB entries) 
Domain d1pif_1: 1pif 404-496 [27765]
Other proteins in same PDB: d1pif_2
Details for d1pif_1
PDB Entry: 1pif (more details), 2.3 Å
PDB Description: pig alpha-amylase
SCOP Domain Sequences for d1pif_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pif_1 b.71.1.1 (404-496) Animal alpha-amylase {Pig (Sus scrofa)}
qpfanwwdngsnqvafgrgnrgfivfnnddwqlsstlqtglpggtycnvisgdkvgnsct
gikvyvssdgtaqfsisnsaqdpfiaihaeskl
SCOP Domain Coordinates for d1pif_1:
Click to download the PDB-style file with coordinates for d1pif_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pif_1:
- d1pif_1 first appeared (with stable ids) in SCOP 1.55
- d1pif_1 appears in SCOP 1.59
- d1pif_1 appears in the current release, SCOPe 2.08, called d1pifa1
View in 3D
