SCOPe 2.05: Domain d4xhuc2: 4xhu C:797-1009

Lineage for d4xhuc2 (4xhu C:797-1009)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.0: automated matches [191650] (1 protein)
   not a true family

6. Protein automated matches [191197] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225406] (26 PDB entries)

8. Domain d4xhuc2: 4xhu C:797-1009 [277640]
   Other proteins in same PDB: d4xhua1, d4xhuc1
   automated match to d4hhyd2
   protein/DNA complex; complexed with act, ca, gol

Details for d4xhuc2

PDB Entry: 4xhu, 2.09 Å

PDB Description: the complex structure of timeless_pab and parp-1_catalytic domain

PDB Compounds: (C:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d4xhuc2:

Sequence, based on SEQRES records:

>d4xhuc2 d.166.1.0 (C:797-1009) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnf

Sequence, based on observed residues (ATOM records):

>d4xhuc2 d.166.1.0 (C:797-1009) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthaydlevidifkieregecqrykpfkqlhnrrllw
hgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpiglill
gevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgissgvdt
sllyneyivydiaqvnlkyllklkfnf

Timeline for d4xhuc2:

• d4xhuc2 is new in SCOPe 2.05-stable
  
• d4xhuc2 appears in SCOPe 2.06
  
• d4xhuc2 appears in the current release, SCOPe 2.08