SCOPe 2.05: Domain d4xhua1: 4xhu A:661-796

Lineage for d4xhua1 (4xhu A:661-796)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
   core: 4 helices: bundle; unusual topology

4. Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families)
   duplication: consists of 2 helix-loop-helix structural repeats
   automatically mapped to Pfam PF02877

5. Family a.41.1.0: automated matches [227223] (1 protein)
   not a true family

6. Protein automated matches [226964] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225405] (32 PDB entries)

8. Domain d4xhua1: 4xhu A:661-796 [277636]
   Other proteins in same PDB: d4xhua2, d4xhuc2
   automated match to d4hhyd1
   protein/DNA complex; complexed with act, ca, gol

Details for d4xhua1

PDB Entry: 4xhu, 2.09 Å

PDB Description: the complex structure of timeless_pab and parp-1_catalytic domain

PDB Compounds: (A:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d4xhua1:

Sequence, based on SEQRES records:

>d4xhua1 a.41.1.0 (A:661-796) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqav
sqgssdsqildlsnrfytliphdfgmkkppllnnadsvqakvemldnlldievaysllrg
gsddsskdpidvnyek

Sequence, based on observed residues (ATOM records):

>d4xhua1 a.41.1.0 (A:661-796) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqav
sqildlsnrfytliphdfgmkkppllnnadsvqakvemldnlldievaysllrsskdpid
vnyek

Timeline for d4xhua1:

• d4xhua1 is new in SCOPe 2.05-stable
  
• d4xhua1 appears in SCOPe 2.06
  
• d4xhua1 appears in the current release, SCOPe 2.08