SCOPe 2.05: Domain d4wi5a2: 4wi5 A:340-444

Lineage for d4wi5a2 (4wi5 A:340-444)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88590] (49 PDB entries)
   Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region

8. Domain d4wi5a2: 4wi5 A:340-444 [277627]
   Other proteins in same PDB: d4wi5a1, d4wi5b1
   automated match to d3d6ga2
   complexed with bma, edo, fuc, man, nag; mutant

Details for d4wi5a2

PDB Entry: 4wi5, 2.8 Å

PDB Description: structural mapping of the human igg1 binding site for fcrn: hu3s193 fc mutation h310a

PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d4wi5a2:

Sequence; same for both SEQRES and ATOM records:

>d4wi5a2 b.1.1.2 (A:340-444) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
kgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvld
sdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsls

Timeline for d4wi5a2:

• d4wi5a2 is new in SCOPe 2.05-stable
  
• d4wi5a2 appears in SCOPe 2.06
  
• d4wi5a2 appears in the current release, SCOPe 2.08