Class b: All beta proteins [48724] (176 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Animal alpha-amylase [51024] (3 species) |
Species Pig (Sus scrofa) [TaxId:9823] [51025] (13 PDB entries) |
Domain d1jfha1: 1jfh A:404-496 [27762] Other proteins in same PDB: d1jfha2 complexed with ca, cl, glc, hg, ma1, ma2, ma3 |
PDB Entry: 1jfh (more details), 2.03 Å
SCOPe Domain Sequences for d1jfha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jfha1 b.71.1.1 (A:404-496) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} epfanwwdngsnqvafgrgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsct gikvyvssdgtaqfsisnsaedpfiaihaeskl
Timeline for d1jfha1: