Lineage for d1a47a3 (1a47 A:407-495)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1327893Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1327894Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1327895Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 1328053Protein Cyclodextrin glycosyltransferase [51018] (5 species)
    contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like
  7. 1328117Species Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId:33950] [51023] (4 PDB entries)
  8. 1328121Domain d1a47a3: 1a47 A:407-495 [27760]
    Other proteins in same PDB: d1a47a1, d1a47a2, d1a47a4
    complexed with ca

Details for d1a47a3

PDB Entry: 1a47 (more details), 2.56 Å

PDB Description: cgtase from thermoanaerobacterium thermosulfurigenes em1 in complex with a maltohexaose inhibitor
PDB Compounds: (A:) cyclodextrin glycosyltransferase

SCOPe Domain Sequences for d1a47a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a47a3 b.71.1.1 (A:407-495) Cyclodextrin glycosyltransferase {Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId: 33950]}
gttqqrwinndvyiyerkfgnnvalvainrnlstsynitglytalpagtytdvlggllng
nsisvasdgsvtpftlsagevavwqyvss

SCOPe Domain Coordinates for d1a47a3:

Click to download the PDB-style file with coordinates for d1a47a3.
(The format of our PDB-style files is described here.)

Timeline for d1a47a3: