Lineage for d4v0za_ (4v0z A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781267Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
    contains many insertions in the common fold
    automatically mapped to Pfam PF00840
  6. 1781325Protein automated matches [190170] (12 species)
    not a true protein
  7. 1781366Species Trichoderma reesei [TaxId:334564] [270238] (2 PDB entries)
  8. 1781368Domain d4v0za_: 4v0z A: [277594]
    automated match to d1q2ba_
    complexed with co, gol, nag, opo, peg

Details for d4v0za_

PDB Entry: 4v0z (more details), 1.7 Å

PDB Description: o-nitrophenyl cellobioside as an active site probe for family 7 cellobiohydrolases
PDB Compounds: (A:) cellobiohydrolase cel7a

SCOPe Domain Sequences for d4v0za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4v0za_ b.29.1.10 (A:) automated matches {Trichoderma reesei [TaxId: 334564]}
esactlqsethppltwqkcssggtctqqtgsvvidanwrwthatnsstncydgntwsstl
cpdnetcaknccldgaayastygvttsgnslsigfvtqsaqknvgarlylmasdttyqef
tllgnefsfdvdvsqlpcglngalyfvsmdadggvskyptntagakygtgycdsqcprdl
kfingqanvegwepssnnantgigghgsccsemdiweansisealtphpcttvgqeiceg
dgcggtysdnryggtcdpdgcdwnpyrlgntsfygpgssftldttkkltvvtqfetsgai
nryyvqdgvtfqqpnaelgsysgnelnddyctaeeaefggssfsdkggltqfkkatsggm
vlvmslwddyyanmlwldstyptnetsstpgavrgscstssgvpaqvesqspnakvtfsn
ikfgpigstgnpsg

SCOPe Domain Coordinates for d4v0za_:

Click to download the PDB-style file with coordinates for d4v0za_.
(The format of our PDB-style files is described here.)

Timeline for d4v0za_: