SCOPe 2.07: Domain d1dedb3: 1ded B:407-496

Lineage for d1dedb3 (1ded B:407-496)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Cyclodextrin glycosyltransferase [51018] (5 species)
   contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like

7. Species Bacillus sp., strain 1011 [TaxId:1409] [51022] (8 PDB entries)
   Uniprot P05618

8. Domain d1dedb3: 1ded B:407-496 [27758]
   Other proteins in same PDB: d1deda1, d1deda2, d1deda4, d1dedb1, d1dedb2, d1dedb4
   complexed with ca, qps

Details for d1dedb3

PDB Entry: 1ded, 2 Å

PDB Description: crystal structure of alkalophilic asparagine 233-replaced cyclodextrin glucanotransferase complexed with an inhibitor, acarbose, at 2.0 a resolution

PDB Compounds: (B:) cyclodextrin glucanotransferase

SCOPe Domain Sequences for d1dedb3:

Sequence; same for both SEQRES and ATOM records:

>d1dedb3 b.71.1.1 (B:407-496) Cyclodextrin glycosyltransferase {Bacillus sp., strain 1011 [TaxId: 1409]}
gstherwinndviiyerkfgnnvavvainrnmntpasitglvtslprgsyndvlggilng
ntltvgaggaasnftlapggtavwqyttda

Timeline for d1dedb3:

• d1dedb3 first appeared (with stable ids) in SCOP 1.55
  
• d1dedb3 appears in SCOPe 2.06
  
• d1dedb3 appears in the current release, SCOPe 2.08