Lineage for d1d7fb3 (1d7f B:407-496)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 380059Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 380060Superfamily b.71.1: Glycosyl hydrolase domain [51011] (3 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 380061Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 380170Protein Cyclodextrin glycosyltransferase [51018] (5 species)
    contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like
  7. 380212Species Bacillus sp., strain 1011 [TaxId:1409] [51022] (4 PDB entries)
  8. 380216Domain d1d7fb3: 1d7f B:407-496 [27756]
    Other proteins in same PDB: d1d7fa1, d1d7fa2, d1d7fa4, d1d7fb1, d1d7fb2, d1d7fb4
    complexed with ca; mutant

Details for d1d7fb3

PDB Entry: 1d7f (more details), 1.9 Å

PDB Description: crystal structure of asparagine 233-replaced cyclodextrin glucanotransferase from alkalophilic bacillus sp. 1011 determined at 1.9 a resolution

SCOP Domain Sequences for d1d7fb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d7fb3 b.71.1.1 (B:407-496) Cyclodextrin glycosyltransferase {Bacillus sp., strain 1011}
gstherwinndviiyerkfgnnvavvainrnmntpasitglvtslprgsyndvlggilng
ntltvgaggaasnftlapggtavwqyttda

SCOP Domain Coordinates for d1d7fb3:

Click to download the PDB-style file with coordinates for d1d7fb3.
(The format of our PDB-style files is described here.)

Timeline for d1d7fb3: