Class b: All beta proteins [48724] (177 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Cyclodextrin glycosyltransferase [51018] (5 species) contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like |
Species Bacillus sp., strain 1011 [TaxId:1409] [51022] (8 PDB entries) Uniprot P05618 |
Domain d1d7fa3: 1d7f A:407-496 [27755] Other proteins in same PDB: d1d7fa1, d1d7fa2, d1d7fa4, d1d7fb1, d1d7fb2, d1d7fb4 complexed with ca |
PDB Entry: 1d7f (more details), 1.9 Å
SCOPe Domain Sequences for d1d7fa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d7fa3 b.71.1.1 (A:407-496) Cyclodextrin glycosyltransferase {Bacillus sp., strain 1011 [TaxId: 1409]} gstherwinndviiyerkfgnnvavvainrnmntpasitglvtslprgsyndvlggilng ntltvgaggaasnftlapggtavwqyttda
Timeline for d1d7fa3:
View in 3D Domains from other chains: (mouse over for more information) d1d7fb1, d1d7fb2, d1d7fb3, d1d7fb4 |