Lineage for d1d7fa3 (1d7f A:407-496)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1555652Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1555653Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1555654Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 1555802Protein Cyclodextrin glycosyltransferase [51018] (5 species)
    contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like
  7. 1555844Species Bacillus sp., strain 1011 [TaxId:1409] [51022] (8 PDB entries)
    Uniprot P05618
  8. 1555847Domain d1d7fa3: 1d7f A:407-496 [27755]
    Other proteins in same PDB: d1d7fa1, d1d7fa2, d1d7fa4, d1d7fb1, d1d7fb2, d1d7fb4
    complexed with ca

Details for d1d7fa3

PDB Entry: 1d7f (more details), 1.9 Å

PDB Description: crystal structure of asparagine 233-replaced cyclodextrin glucanotransferase from alkalophilic bacillus sp. 1011 determined at 1.9 a resolution
PDB Compounds: (A:) cyclodextrin glucanotransferase

SCOPe Domain Sequences for d1d7fa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d7fa3 b.71.1.1 (A:407-496) Cyclodextrin glycosyltransferase {Bacillus sp., strain 1011 [TaxId: 1409]}
gstherwinndviiyerkfgnnvavvainrnmntpasitglvtslprgsyndvlggilng
ntltvgaggaasnftlapggtavwqyttda

SCOPe Domain Coordinates for d1d7fa3:

Click to download the PDB-style file with coordinates for d1d7fa3.
(The format of our PDB-style files is described here.)

Timeline for d1d7fa3: