SCOPe 2.05: Domain d4rf4a_: 4rf4 A:

Lineage for d4rf4a_ (4rf4 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (203 species)
   not a true protein

7. Species Lactobacillus kefiri [TaxId:33962] [277547] (4 PDB entries)

8. Domain d4rf4a_: 4rf4 A: [277549]
   automated match to d2rhcb_
   complexed with mg

Details for d4rf4a_

PDB Entry: 4rf4, 2.2 Å

PDB Description: crystal structure of ketoreductase from lactobacillus kefir

PDB Compounds: (A:) NADPH dependent R-specific alcohol dehydrogenase

SCOPe Domain Sequences for d4rf4a_:

Sequence; same for both SEQRES and ATOM records:

>d4rf4a_ c.2.1.0 (A:) automated matches {Lactobacillus kefiri [TaxId: 33962]}
drlkgkvaivtggtlgiglaiadkfveegakvvitgrhadvgekaaksiggtdvirfvqh
dasdeagwtklfdtteeafgpvttvvnnagiavsksvedttteewrkllsvnldgvffgt
rlgiqrmknkglgasiinmssiegfvgdptlgaynaskgavrimsksaaldcalkdydvr
vntvhpgyiktplvddlegaeemmsqrtktpmghigepndiawicvylasdeskfatgae
fvvdggytaq

Timeline for d4rf4a_:

• d4rf4a_ is new in SCOPe 2.05-stable
  
• d4rf4a_ appears in SCOPe 2.06
  
• d4rf4a_ appears in the current release, SCOPe 2.08