Lineage for d1pamb3 (1pam B:407-496)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2076868Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2076869Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2076870Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2077024Protein Cyclodextrin glycosyltransferase [51018] (5 species)
    contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like
  7. 2077066Species Bacillus sp., strain 1011 [TaxId:1409] [51022] (8 PDB entries)
    Uniprot P05618
  8. 2077068Domain d1pamb3: 1pam B:407-496 [27754]
    Other proteins in same PDB: d1pama1, d1pama2, d1pama4, d1pamb1, d1pamb2, d1pamb4
    complexed with ca

Details for d1pamb3

PDB Entry: 1pam (more details), 1.8 Å

PDB Description: cyclodextrin glucanotransferase
PDB Compounds: (B:) cyclodextrin glucanotransferase

SCOPe Domain Sequences for d1pamb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pamb3 b.71.1.1 (B:407-496) Cyclodextrin glycosyltransferase {Bacillus sp., strain 1011 [TaxId: 1409]}
gstherwinndviiyerkfgnnvavvainrnmntpasitglvtslprgsyndvlggilng
ntltvgaggaasnftlapggtavwqyttda

SCOPe Domain Coordinates for d1pamb3:

Click to download the PDB-style file with coordinates for d1pamb3.
(The format of our PDB-style files is described here.)

Timeline for d1pamb3: