Lineage for d2n74a_ (2n74 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697722Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 2697723Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) (S)
  5. 2697724Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins)
  6. 2697725Protein N-terminal, RNA-binding domain of nonstructural protein NS1 [47062] (4 species)
  7. 2697726Species Influenza A virus (a/brevig mission/1/1918(h1n1)) [TaxId:88776] [419762] (1 PDB entry)
  8. 2697727Domain d2n74a_: 2n74 A: [277538]
    automated match to d1ns1a_

Details for d2n74a_

PDB Entry: 2n74 (more details)

PDB Description: solution structure of the rna-binding domain of non-structural protein 1 from the 1918 h1n1 influenza virus
PDB Compounds: (A:) Non-structural protein 1

SCOPe Domain Sequences for d2n74a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n74a_ a.16.1.1 (A:) N-terminal, RNA-binding domain of nonstructural protein NS1 {Influenza A virus (a/brevig mission/1/1918(h1n1)) [TaxId: 88776]}
mdsntvssfqvdcflwhvrkrfadqelgdapfldrlrrdqkslrgrgstlgldietatra
gkqiverilkees

SCOPe Domain Coordinates for d2n74a_:

Click to download the PDB-style file with coordinates for d2n74a_.
(The format of our PDB-style files is described here.)

Timeline for d2n74a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2n74b_