| Class b: All beta proteins [48724] (174 folds) |
| Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
| Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
| Protein Cyclodextrin glycosyltransferase [51018] (5 species) contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like |
| Species Bacillus sp., strain 1011 [TaxId:1409] [51022] (8 PDB entries) Uniprot P05618 |
| Domain d1pama3: 1pam A:407-496 [27753] Other proteins in same PDB: d1pama1, d1pama2, d1pama4, d1pamb1, d1pamb2, d1pamb4 complexed with ca |
PDB Entry: 1pam (more details), 1.8 Å
SCOPe Domain Sequences for d1pama3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pama3 b.71.1.1 (A:407-496) Cyclodextrin glycosyltransferase {Bacillus sp., strain 1011 [TaxId: 1409]}
gstherwinndviiyerkfgnnvavvainrnmntpasitglvtslprgsyndvlggilng
ntltvgaggaasnftlapggtavwqyttda
Timeline for d1pama3:
View in 3DDomains from other chains: (mouse over for more information) d1pamb1, d1pamb2, d1pamb3, d1pamb4 |