Lineage for d1pama3 (1pam A:407-496)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63005Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 63006Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 63007Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (11 proteins)
  6. 63051Protein Cyclodextrin glycosyltransferase [51018] (5 species)
  7. 63081Species Bacillus sp., strain 1011 [TaxId:1409] [51022] (4 PDB entries)
  8. 63082Domain d1pama3: 1pam A:407-496 [27753]
    Other proteins in same PDB: d1pama1, d1pama2, d1pama4, d1pamb1, d1pamb2, d1pamb4

Details for d1pama3

PDB Entry: 1pam (more details), 1.8 Å

PDB Description: cyclodextrin glucanotransferase

SCOP Domain Sequences for d1pama3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pama3 b.71.1.1 (A:407-496) Cyclodextrin glycosyltransferase {Bacillus sp., strain 1011}
gstherwinndviiyerkfgnnvavvainrnmntpasitglvtslprgsyndvlggilng
ntltvgaggaasnftlapggtavwqyttda

SCOP Domain Coordinates for d1pama3:

Click to download the PDB-style file with coordinates for d1pama3.
(The format of our PDB-style files is described here.)

Timeline for d1pama3: