Lineage for d1qhpa3 (1qhp A:408-495)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily) Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) 
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (12 proteins) 
Protein Cyclodextrin glycosyltransferase [51018] (5 species) Species Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId:1422] [51021] (2 PDB entries) 
Domain d1qhpa3: 1qhp A:408-495 [27752]
Other proteins in same PDB: d1qhpa1, d1qhpa2, d1qhpa4
Details for d1qhpa3
PDB Entry: 1qhp (more details), 1.7 Å
PDB Description: five-domain alpha-amylase from bacillus stearothermophilus, maltose complex
SCOP Domain Sequences for d1qhpa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qhpa3 b.71.1.1 (A:408-495) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase}
gtttqrwinndvyiyerkffndvvlvainrntqssysisglqtalpngsyadylsgllgg
ngisvsngsvasftlapgavsvwqysts
SCOP Domain Coordinates for d1qhpa3:
Click to download the PDB-style file with coordinates for d1qhpa3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qhpa3:
- d1qhpa3 first appeared (with stable ids) in SCOP 1.55
- d1qhpa3 appears in SCOP 1.57
- d1qhpa3 appears in SCOP 1.61
- d1qhpa3 appears in the current release, SCOPe 2.08
View in 3D
