Lineage for d1qhoa3 (1qho A:408-495)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2076868Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2076869Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2076870Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2077024Protein Cyclodextrin glycosyltransferase [51018] (5 species)
    contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like
  7. 2077085Species Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId:1422] [51021] (2 PDB entries)
  8. 2077086Domain d1qhoa3: 1qho A:408-495 [27751]
    Other proteins in same PDB: d1qhoa1, d1qhoa2, d1qhoa4
    complexed with abd, ca, mal, so4

Details for d1qhoa3

PDB Entry: 1qho (more details), 1.7 Å

PDB Description: five-domain alpha-amylase from bacillus stearothermophilus, maltose/acarbose complex
PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d1qhoa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qhoa3 b.71.1.1 (A:408-495) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]}
gtttqrwinndvyiyerkffndvvlvainrntqssysisglqtalpngsyadylsgllgg
ngisvsngsvasftlapgavsvwqysts

SCOPe Domain Coordinates for d1qhoa3:

Click to download the PDB-style file with coordinates for d1qhoa3.
(The format of our PDB-style files is described here.)

Timeline for d1qhoa3: