SCOPe 2.05: Domain d5cxoa_: 5cxo A:

Lineage for d5cxoa_ (5cxo A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.0: automated matches [191337] (1 protein)
   not a true family

6. Protein automated matches [190205] (21 species)
   not a true protein

7. Species Streptomyces albus [TaxId:1888] [277508] (1 PDB entry)

8. Domain d5cxoa_: 5cxo A: [277509]
   automated match to d1ocva_
   complexed with p6g

Details for d5cxoa_

PDB Entry: 5cxo, 1.8 Å

PDB Description: intriguing role of epoxide hydrolase/cyclase-like enzyme salbiii in pyran ring formation in polyether salinomycin

PDB Compounds: (A:) epoxide hydrolase

SCOPe Domain Sequences for d5cxoa_:

Sequence; same for both SEQRES and ATOM records:

>d5cxoa_ d.17.4.0 (A:) automated matches {Streptomyces albus [TaxId: 1888]}
mqdeqkrkeivaeyfrkvnegdvdaivemftenatiedpvgkdvregraaqreyfnsnvt
aevtiepghlsagqdgksvavalaaemtnildpnrtrvkinavdvftltpegkidsmrvf
wgmtdigvw

Timeline for d5cxoa_:

• d5cxoa_ is new in SCOPe 2.05-stable
  
• d5cxoa_ is called d5cxoa1 in SCOPe 2.06
  
• d5cxoa_ appears in the current release, SCOPe 2.08, called d5cxoa1