Lineage for d5c91a_ (5c91 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2987810Fold d.148: Hect, E3 ligase catalytic domain [56203] (1 superfamily)
    consists of two alpha+beta domains; the N-terminal domain is array of helices and beta-hairpins; the C-terminal domain is an a/b sandwich with one left-handed beta-alpha(n)-beta unit; conformational flexibility of domain orientation
  4. 2987811Superfamily d.148.1: Hect, E3 ligase catalytic domain [56204] (2 families) (S)
    automatically mapped to Pfam PF00632
  5. 2987827Family d.148.1.0: automated matches [227207] (1 protein)
    not a true family
  6. 2987828Protein automated matches [226939] (2 species)
    not a true protein
  7. 2987832Species Human (Homo sapiens) [TaxId:9606] [225255] (18 PDB entries)
  8. 2987846Domain d5c91a_: 5c91 A: [277506]
    automated match to d4bbna_
    complexed with 4yu

Details for d5c91a_

PDB Entry: 5c91 (more details), 2.44 Å

PDB Description: nedd4 hect with covalently bound indole-based inhibitor
PDB Compounds: (A:) E3 ubiquitin-protein ligase NEDD4

SCOPe Domain Sequences for d5c91a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c91a_ d.148.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srdykrkyeffrrklkkqndipnkfemklrratvledsyrrimgvkradflkarlwiefd
gekgldyggvarewffliskemfnpyyglfeysatdnytlqinpnsglcnedhlsyfkfi
grvagmavyhgklldgffirpfykmmlhkpitlhdmesvdseyynslrwilendpteldl
rfiideelfgqthqhelknggseivvtnknkkeyiylviqwrfvnriqkqmaafkegffe
lipqdlikifdenelellmcglgdvdvndwrehtkykngysanhqviqwfwkavlmmdse
krirllqfvtgtsrvpmngfaelygsngpqsftveqwgtpeklprahtcfnrldlppyes
feelwdklqmaient

SCOPe Domain Coordinates for d5c91a_:

Click to download the PDB-style file with coordinates for d5c91a_.
(The format of our PDB-style files is described here.)

Timeline for d5c91a_: