Class b: All beta proteins [48724] (174 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Cyclodextrin glycosyltransferase [51018] (6 species) contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like |
Species Bacillus stearothermophilus [TaxId:1422] [51020] (1 PDB entry) |
Domain d1cyga3: 1cyg A:403-491 [27750] Other proteins in same PDB: d1cyga1, d1cyga2, d1cyga4 complexed with ca |
PDB Entry: 1cyg (more details), 2.5 Å
SCOP Domain Sequences for d1cyga3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cyga3 b.71.1.1 (A:403-491) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus [TaxId: 1422]} gdteqrwingdvyvyerqfgkdvvlvavnrssssnysitglftalpagtytdqlgglldg ntiqvgsngsvnafdlgpgevgvwaysat
Timeline for d1cyga3: