SCOP 1.75: Domain d1cyga3: 1cyg A:403-491

Lineage for d1cyga3 (1cyg A:403-491)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Cyclodextrin glycosyltransferase [51018] (6 species)
   contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like

7. Species Bacillus stearothermophilus [TaxId:1422] [51020] (1 PDB entry)

8. Domain d1cyga3: 1cyg A:403-491 [27750]
   Other proteins in same PDB: d1cyga1, d1cyga2, d1cyga4
   complexed with ca

Details for d1cyga3

PDB Entry: 1cyg, 2.5 Å

PDB Description: cyclodextrin glucanotransferase (e.c.2.4.1.19) (cgtase)

PDB Compounds: (A:) cyclodextrin glucanotransferase

SCOP Domain Sequences for d1cyga3:

Sequence; same for both SEQRES and ATOM records:

>d1cyga3 b.71.1.1 (A:403-491) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus [TaxId: 1422]}
gdteqrwingdvyvyerqfgkdvvlvavnrssssnysitglftalpagtytdqlgglldg
ntiqvgsngsvnafdlgpgevgvwaysat

Timeline for d1cyga3:

• d1cyga3 first appeared (with stable ids) in SCOP 1.55, called d1cyg_3
  
• d1cyga3 appears in SCOP 1.73
  
• d1cyga3 appears in SCOPe 2.01
  
• d1cyga3 appears in the current release, SCOPe 2.08