SCOP 1.69: Domain d1cyg_3: 1cyg 403-491

Lineage for d1cyg_3 (1cyg 403-491)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (3 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Cyclodextrin glycosyltransferase [51018] (5 species)
   contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like

7. Species Bacillus stearothermophilus [TaxId:1422] [51020] (1 PDB entry)

8. Domain d1cyg_3: 1cyg 403-491 [27750]
   Other proteins in same PDB: d1cyg_1, d1cyg_2, d1cyg_4

Details for d1cyg_3

PDB Entry: 1cyg, 2.5 Å

PDB Description: cyclodextrin glucanotransferase (e.c.2.4.1.19) (cgtase)

SCOP Domain Sequences for d1cyg_3:

Sequence; same for both SEQRES and ATOM records:

>d1cyg_3 b.71.1.1 (403-491) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus}
gdteqrwingdvyvyerqfgkdvvlvavnrssssnysitglftalpagtytdqlgglldg
ntiqvgsngsvnafdlgpgevgvwaysat

Timeline for d1cyg_3:

• d1cyg_3 first appeared (with stable ids) in SCOP 1.55
  
• d1cyg_3 appears in SCOP 1.67
  
• d1cyg_3 appears in SCOP 1.71
  
• d1cyg_3 appears in the current release, SCOPe 2.08, called d1cyga3