SCOPe 2.06: Domain d5anmc1: 5anm C:2-112

Lineage for d5anmc1 (5anm C:2-112)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein automated matches [190119] (22 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [188740] (183 PDB entries)
Domain d5anmc1: 5anm C:2-112 [277484]
Other proteins in same PDB: d5anma2, d5anmc2, d5anme1, d5anme2, d5anmf1, d5anmf2, d5anmg1, d5anmg2, d5anml1, d5anml2
automated match to d1aqkl1

Details for d5anmc1

PDB Entry: 5anm (more details), 2.85 Å

PDB Description: crystal structure of ige fc in complex with a neutralizing antibody

PDB Compounds: (C:) immunoglobulin g

SCOPe Domain Sequences for d5anmc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5anmc1 b.1.1.1 (C:2-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svltqppsvsgapgqrvtisctgsssnigagydvhwyqqlpgtapklliydnfnrpsgvp
drfsgsksgtsaslaitglqaedeadyycqsydsptltspfgtgtkltvlg

SCOPe Domain Coordinates for d5anmc1:

Click to download the PDB-style file with coordinates for d5anmc1.
(The format of our PDB-style files is described here.)

Timeline for d5anmc1: