Lineage for d5anmg2 (5anm G:439-545)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1762674Species Homo sapiens [TaxId:9606] [268989] (70 PDB entries)
  8. 1762787Domain d5anmg2: 5anm G:439-545 [277476]
    Other proteins in same PDB: d5anma1, d5anmc1, d5anml1
    automated match to d1f6ab2

Details for d5anmg2

PDB Entry: 5anm (more details), 2.85 Å

PDB Description: crystal structure of ige fc in complex with a neutralizing antibody
PDB Compounds: (G:) ig epsilon chain c region

SCOPe Domain Sequences for d5anmg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5anmg2 b.1.1.2 (G:439-545) automated matches {Homo sapiens [TaxId: 9606]}
praapevyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprkt
kgsgffvfsrlevtraeweqkdeficravheaaspsqtvqravsvnp

SCOPe Domain Coordinates for d5anmg2:

Click to download the PDB-style file with coordinates for d5anmg2.
(The format of our PDB-style files is described here.)

Timeline for d5anmg2: