Class b: All beta proteins [48724] (141 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (3 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Cyclodextrin glycosyltransferase [51018] (5 species) contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like |
Species Bacillus circulans, different strains [TaxId:1397] [51019] (36 PDB entries) |
Domain d2cxg_3: 2cxg 407-495 [27746] Other proteins in same PDB: d2cxg_1, d2cxg_2, d2cxg_4 complexed with aci, ca, glc, gld |
PDB Entry: 2cxg (more details), 2.5 Å
SCOP Domain Sequences for d2cxg_3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cxg_3 b.71.1.1 (407-495) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains} gstqerwinndvliyerkfgsnvavvavnrnlnapasisglvtslpqgsyndvlggllng ntlsvgsggaasnftlaaggtavwqytaa
Timeline for d2cxg_3: