SCOPe 2.06: Domain d4yx2l2: 4yx2 L:108-213

Lineage for d4yx2l2 (4yx2 L:108-213)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries)

8. Domain d4yx2l2: 4yx2 L:108-213 [277456]
   Other proteins in same PDB: d4yx2a_, d4yx2l1
   automated match to d4h88l2

Details for d4yx2l2

PDB Entry: 4yx2, 2.19 Å

PDB Description: crystal structure of bovine prion protein complexed with pom1 fab

PDB Compounds: (L:) POM1 Fab Light chain

SCOPe Domain Sequences for d4yx2l2:

Sequence; same for both SEQRES and ATOM records:

>d4yx2l2 b.1.1.2 (L:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnsetdqd
skdstysmsstltltkdeyerhntytceathktstspivksfnrne

Timeline for d4yx2l2:

• d4yx2l2 first appeared in SCOPe 2.05
  
• d4yx2l2 appears in SCOPe 2.07
  
• d4yx2l2 appears in the current release, SCOPe 2.08