SCOPe 2.05: Domain d4z8ma_: 4z8m A:

Lineage for d4z8ma_ (4z8m A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.8: TRAF domain-like [49598] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.8.1: TRAF domain-like [49599] (3 families)
   has a circularly permuted immunoglobulin-fold topology with extra strand

5. Family b.8.1.1: MATH domain [49600] (5 proteins)
   automatically mapped to Pfam PF00917

6. Protein automated matches [277441] (1 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [277442] (1 PDB entry)

8. Domain d4z8ma_: 4z8m A: [277443]
   automated match to d1lb4a_

Details for d4z8ma_

PDB Entry: 4z8m, 2.95 Å

PDB Description: crystal structure of the mavs-traf6 complex

PDB Compounds: (A:) TNF receptor-associated factor 6

SCOPe Domain Sequences for d4z8ma_:

Sequence; same for both SEQRES and ATOM records:

>d4z8ma_ b.8.1.1 (A:) automated matches {Homo sapiens [TaxId: 9606]}
ngiyiwkignfgmhlkcqeeekpvvihspgfytgkpgyklcmrlhlqlptaqrcanyisl
fvhtmqgeydshlpwpfqgtirltildqseapvrqnheeimdakpellafqrptiprnpk
gfgyvtfmhlealrqrtfikddtllvrcevst

Timeline for d4z8ma_:

• d4z8ma_ is new in SCOPe 2.05-stable
  
• d4z8ma_ appears in SCOPe 2.06
  
• d4z8ma_ appears in the current release, SCOPe 2.08