SCOPe 2.05: Domain d6cgta3: 6cgt A:407-494

Lineage for d6cgta3 (6cgt A:407-494)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Cyclodextrin glycosyltransferase [51018] (5 species)
   contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like

7. Species Bacillus circulans, different strains [TaxId:1397] [51019] (36 PDB entries)

8. Domain d6cgta3: 6cgt A:407-494 [27744]
   Other proteins in same PDB: d6cgta1, d6cgta2, d6cgta4
   complexed with ca; mutant

Details for d6cgta3

PDB Entry: 6cgt, 2.6 Å

PDB Description: hoxa complex of cyclodextrin glycosyltransferase mutant

PDB Compounds: (A:) cyclodextrin glycosyltransferase

SCOPe Domain Sequences for d6cgta3:

Sequence; same for both SEQRES and ATOM records:

>d6cgta3 b.71.1.1 (A:407-494) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains [TaxId: 1397]}
gstqqrwinndvyvyerkfgksvavvavnrnlstsasitglstslptgsytdvlggvlng
nnitstngsinnftlaagatavwqytta

Timeline for d6cgta3:

• d6cgta3 first appeared (with stable ids) in SCOP 1.55, called d6cgt_3
  
• d6cgta3 appears in SCOPe 2.04
  
• d6cgta3 appears in SCOPe 2.06
  
• d6cgta3 appears in the current release, SCOPe 2.08