SCOP 1.71: Domain d6cgt_3: 6cgt 407-494

Lineage for d6cgt_3 (6cgt 407-494)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Cyclodextrin glycosyltransferase [51018] (5 species)
   contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like

7. Species Bacillus circulans, different strains [TaxId:1397] [51019] (36 PDB entries)

8. Domain d6cgt_3: 6cgt 407-494 [27744]
   Other proteins in same PDB: d6cgt_1, d6cgt_2, d6cgt_4
   complexed with ca, dag, glc, opg; mutant

Details for d6cgt_3

PDB Entry: 6cgt, 2.6 Å

PDB Description: hoxa complex of cyclodextrin glycosyltransferase mutant

SCOP Domain Sequences for d6cgt_3:

Sequence; same for both SEQRES and ATOM records:

>d6cgt_3 b.71.1.1 (407-494) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains}
gstqqrwinndvyvyerkfgksvavvavnrnlstsasitglstslptgsytdvlggvlng
nnitstngsinnftlaagatavwqytta

Timeline for d6cgt_3:

• d6cgt_3 first appeared (with stable ids) in SCOP 1.55
  
• d6cgt_3 appears in SCOP 1.69
  
• d6cgt_3 is called d6cgta3 in SCOP 1.73
  
• d6cgt_3 appears in the current release, SCOPe 2.08, called d6cgta3