Lineage for d6cgt_3 (6cgt 407-494)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63005Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 63006Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 63007Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (11 proteins)
  6. 63051Protein Cyclodextrin glycosyltransferase [51018] (5 species)
  7. 63052Species Bacillus circulans, different strains [TaxId:1397] [51019] (27 PDB entries)
  8. 63073Domain d6cgt_3: 6cgt 407-494 [27744]
    Other proteins in same PDB: d6cgt_1, d6cgt_2, d6cgt_4

Details for d6cgt_3

PDB Entry: 6cgt (more details), 2.6 Å

PDB Description: hoxa complex of cyclodextrin glycosyltransferase mutant

SCOP Domain Sequences for d6cgt_3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cgt_3 b.71.1.1 (407-494) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains}
gstqqrwinndvyvyerkfgksvavvavnrnlstsasitglstslptgsytdvlggvlng
nnitstngsinnftlaagatavwqytta

SCOP Domain Coordinates for d6cgt_3:

Click to download the PDB-style file with coordinates for d6cgt_3.
(The format of our PDB-style files is described here.)

Timeline for d6cgt_3: