Lineage for d4yz2a1 (4yz2 A:84-273)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2051795Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2051796Protein automated matches [190437] (53 species)
    not a true protein
  7. 2052258Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [277387] (9 PDB entries)
  8. 2052265Domain d4yz2a1: 4yz2 A:84-273 [277425]
    Other proteins in same PDB: d4yz2a2, d4yz2b2, d4yz2b3
    automated match to d2slia1
    complexed with dan, so4

Details for d4yz2a1

PDB Entry: 4yz2 (more details), 2.06 Å

PDB Description: crystal structure of streptococcus pneumoniae nanc, in complex with 2- deoxy-2,3-didehydro-n-acetylneuraminic acid.
PDB Compounds: (A:) Sialidase NanC

SCOPe Domain Sequences for d4yz2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yz2a1 b.29.1.0 (A:84-273) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
tpvleknnvtltgggenvtkelkdkftsgdftvvikynqssekglqalfgisnskpgqqn
syvdvflrdngelgmeardtssnknnlvsrpasvwgkykqeavtntvavvadsvkktysl
yangtkvvekkvdnflnikdikgidyymlggvkragktafgfngtlenikffnsaldeet
vkkmttnavt

SCOPe Domain Coordinates for d4yz2a1:

Click to download the PDB-style file with coordinates for d4yz2a1.
(The format of our PDB-style files is described here.)

Timeline for d4yz2a1: