Lineage for d4yxha_ (4yxh A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1890617Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 1890618Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 1890619Family d.6.1.1: Prion-like [54099] (3 proteins)
  6. 1890683Protein automated matches [191016] (9 species)
    not a true protein
  7. 1890718Species Odocoileus hemionus [TaxId:9872] [277423] (1 PDB entry)
  8. 1890719Domain d4yxha_: 4yxh A: [277424]
    Other proteins in same PDB: d4yxhl1, d4yxhl2
    automated match to d4hlsb_
    complexed with na

Details for d4yxha_

PDB Entry: 4yxh (more details), 2.7 Å

PDB Description: crystal structure of deer prion protein complexed with pom1 fab
PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d4yxha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yxha_ d.6.1.1 (A:) automated matches {Odocoileus hemionus [TaxId: 9872]}
lggymlgsamnrplihfgndyedryyrenmyrypnqvyyrpvdqynnqntfvhdcvnitv
kqhtvttttkgenftetdikmmervveqmcitqyqresqay

SCOPe Domain Coordinates for d4yxha_:

Click to download the PDB-style file with coordinates for d4yxha_.
(The format of our PDB-style files is described here.)

Timeline for d4yxha_: