Lineage for d4yxka_ (4yxk A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1890617Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 1890618Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 1890619Family d.6.1.1: Prion-like [54099] (3 proteins)
  6. 1890683Protein automated matches [191016] (9 species)
    not a true protein
  7. 1890686Species Cervus elaphus [TaxId:9864] [277421] (1 PDB entry)
  8. 1890687Domain d4yxka_: 4yxk A: [277422]
    Other proteins in same PDB: d4yxkl1, d4yxkl2
    automated match to d4hlsb_
    complexed with na

Details for d4yxka_

PDB Entry: 4yxk (more details), 2.81 Å

PDB Description: crystal structure of elk prion protein complexed with pom1 fab
PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d4yxka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yxka_ d.6.1.1 (A:) automated matches {Cervus elaphus [TaxId: 9864]}
gglggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdqynnqntfvhdcvni
tvkqhtvttttkgenftetdikmmervveqmcitqyqrese

SCOPe Domain Coordinates for d4yxka_:

Click to download the PDB-style file with coordinates for d4yxka_.
(The format of our PDB-style files is described here.)

Timeline for d4yxka_: