Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.6: Prion-like [54097] (1 superfamily) beta-alpha-beta-alpha(2); antiparallel beta-ribbon |
Superfamily d.6.1: Prion-like [54098] (1 family) |
Family d.6.1.1: Prion-like [54099] (3 proteins) |
Protein automated matches [191016] (9 species) not a true protein |
Species Cervus elaphus [TaxId:9864] [277421] (1 PDB entry) |
Domain d4yxka_: 4yxk A: [277422] Other proteins in same PDB: d4yxkl1, d4yxkl2 automated match to d4hlsb_ complexed with na |
PDB Entry: 4yxk (more details), 2.81 Å
SCOPe Domain Sequences for d4yxka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yxka_ d.6.1.1 (A:) automated matches {Cervus elaphus [TaxId: 9864]} gglggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdqynnqntfvhdcvni tvkqhtvttttkgenftetdikmmervveqmcitqyqrese
Timeline for d4yxka_: