SCOPe 2.05: Domain d4yx2a_: 4yx2 A:

Lineage for d4yx2a_ (4yx2 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.6: Prion-like [54097] (1 superfamily)
   beta-alpha-beta-alpha(2); antiparallel beta-ribbon

4. Superfamily d.6.1: Prion-like [54098] (1 family)

5. Family d.6.1.1: Prion-like [54099] (3 proteins)

6. Protein automated matches [191016] (9 species)
   not a true protein

7. Species Bos taurus [TaxId:9913] [277419] (1 PDB entry)

8. Domain d4yx2a_: 4yx2 A: [277420]
   Other proteins in same PDB: d4yx2l1, d4yx2l2
   automated match to d1fo7a_

Details for d4yx2a_

PDB Entry: 4yx2, 2.19 Å

PDB Description: crystal structure of bovine prion protein complexed with pom1 fab

PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d4yx2a_:

Sequence; same for both SEQRES and ATOM records:

>d4yx2a_ d.6.1.1 (A:) automated matches {Bos taurus [TaxId: 9913]}
lggymlgsamsrplihfgsdyedryyrenmhrypnqvyyrpvdqysnqnnfvhdcvnitv
kehtvttttkgenftetdikmmervveqmcitqyqresqay

Timeline for d4yx2a_:

• d4yx2a_ is new in SCOPe 2.05-stable
  
• d4yx2a_ appears in SCOPe 2.06
  
• d4yx2a_ appears in the current release, SCOPe 2.07