Lineage for d1cxka3 (1cxk A:407-496)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2419799Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2419800Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2419801Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2419962Protein Cyclodextrin glycosyltransferase [51018] (5 species)
    contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like
  7. 2419963Species Bacillus circulans, different strains [TaxId:1397] [51019] (36 PDB entries)
  8. 2419995Domain d1cxka3: 1cxk A:407-496 [27742]
    Other proteins in same PDB: d1cxka1, d1cxka2, d1cxka4
    complexed with ca, glc

Details for d1cxka3

PDB Entry: 1cxk (more details), 2.09 Å

PDB Description: complex between a maltononaose substrate and bacillus circulans strain 251 cgtase e257q/d229n
PDB Compounds: (A:) protein (cyclodextrin-glycosyltransferase)

SCOPe Domain Sequences for d1cxka3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cxka3 b.71.1.1 (A:407-496) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains [TaxId: 1397]}
gstqerwinndvliyerkfgsnvavvavnrnlnapasisglvtslpqgsyndvlggllng
ntlsvgsggaasnftlaaggtavwqytaat

SCOPe Domain Coordinates for d1cxka3:

Click to download the PDB-style file with coordinates for d1cxka3.
(The format of our PDB-style files is described here.)

Timeline for d1cxka3: