SCOPe 2.05: Domain d4yw0b1: 4yw0 B:83-273

Lineage for d4yw0b1 (4yw0 B:83-273)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (37 species)
   not a true protein

7. Species Streptococcus pneumoniae [TaxId:1313] [277387] (8 PDB entries)

8. Domain d4yw0b1: 4yw0 B:83-273 [277405]
   Other proteins in same PDB: d4yw0a2, d4yw0b2
   automated match to d2slia1
   complexed with fsi, gol, sfj

Details for d4yw0b1

PDB Entry: 4yw0, 2.05 Å

PDB Description: crystal structure of streptococcus pneumoniae nanc, covalent complex with a fluorinated neu5ac derivative

PDB Compounds: (B:) Neuraminidase C

SCOPe Domain Sequences for d4yw0b1:

Sequence; same for both SEQRES and ATOM records:

>d4yw0b1 b.29.1.0 (B:83-273) automated matches {Streptococcus pneumoniae [TaxId: 1313]}
etpvleknnvtltgggenvtkelkdkftsgdftvvikynqssekglqalfgisnskpgqq
nsyvdvflrdngelgmeardtssnknnlvsrpasvwgkykqeavtntvavvadsvkktys
lyangtkvvekkvdnflnikdikgidyymlggvkragktafgfngtlenikffnsaldee
tvkkmttnavt

Timeline for d4yw0b1:

• d4yw0b1 is new in SCOPe 2.05-stable
  
• d4yw0b1 does not appear in SCOPe 2.06