Class b: All beta proteins [48724] (174 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Cyclodextrin glycosyltransferase [51018] (5 species) contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like |
Species Bacillus circulans, different strains [TaxId:1397] [51019] (36 PDB entries) |
Domain d1tcma3: 1tcm A:407-495 [27740] Other proteins in same PDB: d1tcma1, d1tcma2, d1tcma4, d1tcmb1, d1tcmb2, d1tcmb4 complexed with ca; mutant |
PDB Entry: 1tcm (more details), 2.2 Å
SCOPe Domain Sequences for d1tcma3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tcma3 b.71.1.1 (A:407-495) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains [TaxId: 1397]} gstqerwinndvliyerkfgsnvavvavnrnlnapasisglvtslpqgsyndvlggllng ntlsvgsggaasnftlaaggtavwqytaa
Timeline for d1tcma3:
View in 3D Domains from other chains: (mouse over for more information) d1tcmb1, d1tcmb2, d1tcmb3, d1tcmb4 |