Class b: All beta proteins [48724] (180 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.1: Sialidases [50939] (3 families) |
Family b.68.1.0: automated matches [191452] (1 protein) not a true family |
Protein automated matches [190692] (20 species) not a true protein |
Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [277389] (9 PDB entries) |
Domain d4yw2b2: 4yw2 B:274-740 [277398] Other proteins in same PDB: d4yw2a1, d4yw2a3, d4yw2b1, d4yw2b3 automated match to d2slia2 complexed with gol, peg, po4 |
PDB Entry: 4yw2 (more details), 2 Å
SCOPe Domain Sequences for d4yw2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yw2b2 b.68.1.0 (B:274-740) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} ghliytandttgsnyfripvlytfsngrvfssidaryggthdflnkiniatsysddngkt wtkpkltlafddfapvplewprevggrdlqisggatyidsvivekknkqvlmfadvmpag vsfreatrkdsgykqidgnyylklrkqgdtdynytirengtvyddrtnrptefsvdknfg ikqngnyltveqysvsfennkkteyrngtkvhmnifykdalfkvvptnyiayissndhge swsaptllppimglnrnapylgpgrgiiesstgrilipsytgkesafiysddngaswkvk vvplpsswsaeaqfvelspgviqaymrtnngkiayltskdagttwsapeylkfvsnpsyg tqlsiinysqlidgkkavilstpnstngrkhgqiwiglinddntidwryhhdvdysnygy systltelpnheiglmfekfdswsrnelhmknvvpyitfkiedlkkn
Timeline for d4yw2b2: