Lineage for d8cgta3 (8cgt A:407-494)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2076868Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2076869Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2076870Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2077024Protein Cyclodextrin glycosyltransferase [51018] (5 species)
    contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like
  7. 2077025Species Bacillus circulans, different strains [TaxId:1397] [51019] (36 PDB entries)
  8. 2077047Domain d8cgta3: 8cgt A:407-494 [27738]
    Other proteins in same PDB: d8cgta1, d8cgta2, d8cgta4
    complexed with ca, tm6

Details for d8cgta3

PDB Entry: 8cgt (more details), 2.4 Å

PDB Description: structure of cyclodextrin glycosyltransferase complexed with a thio- maltohexaose
PDB Compounds: (A:) protein (cyclodextrin-glycosyltransferase)

SCOPe Domain Sequences for d8cgta3:

Sequence; same for both SEQRES and ATOM records: (download)

>d8cgta3 b.71.1.1 (A:407-494) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains [TaxId: 1397]}
gstqqrwinndvyvyerkfgksvavvavnrnlstsasitglstslptgsytdvlggvlng
nnitstngsinnftlaagatavwqytta

SCOPe Domain Coordinates for d8cgta3:

Click to download the PDB-style file with coordinates for d8cgta3.
(The format of our PDB-style files is described here.)

Timeline for d8cgta3: