Lineage for d4yu4c_ (4yu4 C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976495Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1978657Protein automated matches [190359] (42 species)
    not a true protein
  7. 1978861Species Helogale parvula [TaxId:210647] [277372] (2 PDB entries)
  8. 1978866Domain d4yu4c_: 4yu4 C: [277378]
    automated match to d3lqda_
    complexed with hem, oxy

Details for d4yu4c_

PDB Entry: 4yu4 (more details), 2.8 Å

PDB Description: crystal structure of mongoose (helogale parvula) hemoglobin at ph 7.0
PDB Compounds: (C:) hemoglobin

SCOPe Domain Sequences for d4yu4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yu4c_ a.1.1.2 (C:) automated matches {Helogale parvula [TaxId: 210647]}
vlspadktnikaswekigshggeygaealertflcfpttktyfphfdlshgsaqvkahgk
kvadaltnavghlddlpgalsalsdlhayklrvdpvnfkllshcllvtlashhpaeftpa
vhasldkflssvstvltskyr

SCOPe Domain Coordinates for d4yu4c_:

Click to download the PDB-style file with coordinates for d4yu4c_.
(The format of our PDB-style files is described here.)

Timeline for d4yu4c_: