SCOPe 2.05: Domain d4xqdb_: 4xqd B:

Lineage for d4xqdb_ (4xqd B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein Xylanase II [49979] (19 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Hypocrea jecorina [TaxId:51453] [277348] (3 PDB entries)

8. Domain d4xqdb_: 4xqd B: [277351]
   automated match to d2jica_
   complexed with iod, trs

Details for d4xqdb_

PDB Entry: 4xqd, 1.5 Å

PDB Description: x-ray structure analysis of xylanase-wt at ph4.0

PDB Compounds: (B:) Endo-1,4-beta-xylanase 2

SCOPe Domain Sequences for d4xqdb_:

Sequence; same for both SEQRES and ATOM records:

>d4xqdb_ b.29.1.11 (B:) Xylanase II {Hypocrea jecorina [TaxId: 51453]}
tiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvin
fsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrtq
rvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyfs
sgsasitvs

Timeline for d4xqdb_:

• d4xqdb_ is new in SCOPe 2.05-stable
  
• d4xqdb_ appears in SCOPe 2.06
  
• d4xqdb_ appears in the current release, SCOPe 2.08