SCOPe 2.05: Domain d4xh5a1: 4xh5 A:4-192

Lineage for d4xh5a1 (4xh5 A:4-192)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.2: Acetokinase-like [53080] (4 proteins)

6. Protein automated matches [277339] (1 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:99287] [277340] (3 PDB entries)

8. Domain d4xh5a1: 4xh5 A:4-192 [277345]
   automated match to d2e1za1
   complexed with anp, gol, ppi, so4; mutant

Details for d4xh5a1

PDB Entry: 4xh5, 2.11 Å

PDB Description: crystal structure of salmonella typhimurium propionate kinase a88g mutant, in complex with amppnp and propionate

PDB Compounds: (A:) Propionate kinase

SCOPe Domain Sequences for d4xh5a1:

Sequence, based on SEQRES records:

>d4xh5a1 c.55.1.2 (A:4-192) automated matches {Salmonella typhimurium [TaxId: 99287]}
fpvvlvincgsssikfsvldvatcdvlmagiadgmntenaflsingdkpinlahsnyeda
lkaiafelekrdltdsvalighrighggelftqsviitdeiidnirrvsplaplhnyanl
sgidaarhlfpavrqvavfdtsfhqtlapeaylyglpweyfsslgvrrygfhgtshryvs
rrayelldl

Sequence, based on observed residues (ATOM records):

>d4xh5a1 c.55.1.2 (A:4-192) automated matches {Salmonella typhimurium [TaxId: 99287]}
fpvvlvincgsssikfsvldvatcdvlmagiadgmtenaflsindkpinlahsnyedalk
aiafelekrdltdsvalighrighggelftqsviitdeiidnirrvsplaplhnyanlsg
idaarhlfpavrqvavfdtsfhqtlapeaylyglpweyfsslgvrrygfhgtshryvsrr
ayelldl

Timeline for d4xh5a1:

• d4xh5a1 is new in SCOPe 2.05-stable
  
• d4xh5a1 appears in SCOPe 2.06
  
• d4xh5a1 appears in the current release, SCOPe 2.08