SCOP 1.75: Domain d1d3ca3: 1d3c A:407-496

Lineage for d1d3ca3 (1d3c A:407-496)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Cyclodextrin glycosyltransferase [51018] (6 species)
   contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like

7. Species Bacillus circulans, different strains [TaxId:1397] [51019] (36 PDB entries)

8. Domain d1d3ca3: 1d3c A:407-496 [27734]
   Other proteins in same PDB: d1d3ca1, d1d3ca2, d1d3ca4

Details for d1d3ca3

PDB Entry: 1d3c, 1.78 Å

PDB Description: michaelis complex of bacillus circulans strain 251 cyclodextrin glycosyltransferase with gamma-cyclodextrin

PDB Compounds: (A:) cyclodextrin glycosyltransferase

SCOP Domain Sequences for d1d3ca3:

Sequence; same for both SEQRES and ATOM records:

>d1d3ca3 b.71.1.1 (A:407-496) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains [TaxId: 1397]}
gstqerwinndvliyerkfgsnvavvavnrnlnapasisglvtslpqgsyndvlggllng
ntlsvgsggaasnftlaaggtavwqytaat

Timeline for d1d3ca3:

• d1d3ca3 first appeared (with stable ids) in SCOP 1.55
  
• d1d3ca3 appears in SCOP 1.73
  
• d1d3ca3 appears in SCOPe 2.01
  
• d1d3ca3 appears in the current release, SCOPe 2.08