![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
![]() | Protein Cyclodextrin glycosyltransferase [51018] (5 species) contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like |
![]() | Species Bacillus circulans, different strains [TaxId:1397] [51019] (36 PDB entries) |
![]() | Domain d1d3ca3: 1d3c A:407-496 [27734] Other proteins in same PDB: d1d3ca1, d1d3ca2, d1d3ca4 complexed with ca, mpd has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1d3c (more details), 1.78 Å
SCOPe Domain Sequences for d1d3ca3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d3ca3 b.71.1.1 (A:407-496) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains [TaxId: 1397]} gstqerwinndvliyerkfgsnvavvavnrnlnapasisglvtslpqgsyndvlggllng ntlsvgsggaasnftlaaggtavwqytaat
Timeline for d1d3ca3: