Lineage for d7cgt_3 (7cgt 407-495)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17288Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 17289Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 17290Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (10 proteins)
  6. 17324Protein Cyclodextrin glycosyltransferase [51018] (5 species)
  7. 17325Species Bacillus circulans, different strains [TaxId:1397] [51019] (27 PDB entries)
  8. 17353Domain d7cgt_3: 7cgt 407-495 [27733]
    Other proteins in same PDB: d7cgt_1, d7cgt_2, d7cgt_4

Details for d7cgt_3

PDB Entry: 7cgt (more details), 3 Å

PDB Description: rameb complex of cyclodextrin glycosyltransferase mutant

SCOP Domain Sequences for d7cgt_3:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cgt_3 b.71.1.1 (407-495) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains}
gstqqrwinndvyvyerkfgksvavvavnrnlstsasitglstslptgsytdvlggvlng
nnitstngsinnftlaagatavwqyttae

SCOP Domain Coordinates for d7cgt_3:

Click to download the PDB-style file with coordinates for d7cgt_3.
(The format of our PDB-style files is described here.)

Timeline for d7cgt_3: