SCOPe 2.05: Domain d4wavb_: 4wav B:

Lineage for d4wavb_ (4wav B:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.13: Family A G protein-coupled receptor-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Family A G protein-coupled receptor-like [81321] (3 families)

5. Family f.13.1.0: automated matches [227143] (1 protein)
   not a true family

6. Protein automated matches [226845] (12 species)
   not a true protein

7. Species Haloquadratum walsbyi [TaxId:768065] [277306] (1 PDB entry)

8. Domain d4wavb_: 4wav B: [277311]
   automated match to d1cwqa_
   complexed with mpg, ret; mutant

Details for d4wavb_

PDB Entry: 4wav, 2.8 Å

PDB Description: crystal structure of haloquadratum walsbyi bacteriorhodopsin mutant d93n

PDB Compounds: (B:) Bacteriorhodopsin-I

SCOPe Domain Sequences for d4wavb_:

Sequence; same for both SEQRES and ATOM records:

>d4wavb_ f.13.1.0 (B:) automated matches {Haloquadratum walsbyi [TaxId: 768065]}
lgvegegiwlalgtigmllgmlyfiadgldvqdprqkefyvitilipaiaaasylsmffg
fgltevslangrvvdvywaryanwlfttplllldigllagasqrdigalvgidafmivtg
lvatltkvvvaryafwtistismvfllyylvavfgeavsdadedtrstfnalrniilvtw
aiypvawlvgteglaltglygetllfmvldlvakvgfgfillrsra

Timeline for d4wavb_:

• d4wavb_ is new in SCOPe 2.05-stable
  
• d4wavb_ appears in SCOPe 2.06
  
• d4wavb_ appears in the current release, SCOPe 2.08