Lineage for d1cgw_3 (1cgw 407-495)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 114424Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 114425Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 114426Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (12 proteins)
  6. 114479Protein Cyclodextrin glycosyltransferase [51018] (5 species)
  7. 114480Species Bacillus circulans, different strains [TaxId:1397] [51019] (29 PDB entries)
  8. 114494Domain d1cgw_3: 1cgw 407-495 [27729]
    Other proteins in same PDB: d1cgw_1, d1cgw_2, d1cgw_4

Details for d1cgw_3

PDB Entry: 1cgw (more details), 2.53 Å

PDB Description: site directed mutations of the active site residue tyrosine 195 of cyclodextrin glycosyltransferase from bacillus circulans strain 251 affecting activity and product specificity

SCOP Domain Sequences for d1cgw_3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cgw_3 b.71.1.1 (407-495) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains}
gstqerwinndvliyerkfgsnvavvavnrnlnapasisglvtslpqgsyndvlggllng
ntlsvgsggaasnftlaaggtavwqytaa

SCOP Domain Coordinates for d1cgw_3:

Click to download the PDB-style file with coordinates for d1cgw_3.
(The format of our PDB-style files is described here.)

Timeline for d1cgw_3: